PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.30146s0002.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 325aa    MW: 34788.2 Da    PI: 9.752
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.30146s0002.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.1e-3977136362
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           e alkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk +
  Araha.30146s0002.2.p  77 EGALKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKGK 136
                           5689****************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3761131IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68380134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSANSNNHPN HPHHHQLQEN GGLVSGHHQV LSHHFPQNPN PNHHHVDTAA AATVDPSSLN  60
GQAAERARLA KNSQPPEGAL KCPRCDSANT KFCYFNNYNL TQPRHFCKAC RRYWTRGGAL  120
RNVPVGGGCR RNKKGKSGNS KSSSSSQNKQ STSMVNATIP TTTSNVQLQT NSQFPFLPDL  180
QNLTQLGGIG LNLAAINGNN GGNGNTSSSF LNELGFFHGG NTSGSVMGNN NNENNIMTSL  240
GSASHFALFD RTMGLYNFPN EGNMGLSFIG ASRVSQTAQV KMEDNHLGSI NRPVSGMTSP  300
GNQSNQYWTG QSLPGSSSND HHLM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0057270.0AC005727.3 Arabidopsis thaliana chromosome 2 clone F8N16 map mi54, complete sequence.
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001189627.10.0Dof zinc finger protein DOF2.2
SwissprotQ9ZV330.0DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLF4IJM60.0F4IJM6_ARATH; Dof zinc finger protein DOF2.2
STRINGAT2G28810.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.21e-153Dof family protein